PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.11G163500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family MYB_related
Protein Properties Length: 212aa    MW: 23955.7 Da    PI: 7.2153
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.11G163500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.29.2e-14110154347
                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
      Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                          +WT+eE+ l++ + +++G+g+W++I+r     Rt+ q+ s+ qky
  Manes.11G163500.1.p 110 PWTEEEHRLFLIGLQRYGKGDWRSISRNAVVSRTPTQVASHAQKY 154
                          8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007175.8E-7456IPR001005SANT/Myb domain
PROSITE profilePS500906.516454IPR017877Myb-like domain
SuperFamilySSF466892.58E-10658IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.2E-5654IPR009057Homeodomain-like
CDDcd001674.34E-6750No hitNo description
PROSITE profilePS5129418.664103159IPR017930Myb domain
SuperFamilySSF466892.94E-17104160IPR009057Homeodomain-like
SMARTSM007178.1E-10107157IPR001005SANT/Myb domain
TIGRFAMsTIGR015572.0E-17107157IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.603.7E-12107153IPR009057Homeodomain-like
CDDcd001675.46E-9110155No hitNo description
PfamPF002492.2E-11110154IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
MIGNSSSWSR LEDKAFERAL VVFPEETLCR WEKIASQVPG KTWFDVKKRY DDLVHDIGEI  60
DSGRVELPSY EDELDCAGGW GSSTESGTSQ VWFGSTAKGK DTTERRKGVP WTEEEHRLFL  120
IGLQRYGKGD WRSISRNAVV SRTPTQVASH AQKYFLRLNS MKKDKKRPSI HDITTNPPTT  180
TTTNDSISTH DFIDPNPFSH PPSYHGFGFP M*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A1e-13370673RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012070162.11e-119PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H72e-56DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A067KUN71e-119A0A067KUN7_JATCU; Uncharacterized protein
STRINGVIT_06s0080g00790.t012e-76(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF60683251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.12e-59MYB family protein